Product Overview
Recombinant mouse RANK, fused to hlgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
RANK, as known as Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A) is a member of the tumor necrosis factor receptor (TNFR) molecular sub-family. It is the receptor for RANK-Ligand (RANKL) and part of the RANK/RANKL/OPG signaling pathway that regulates osteoclast differentiation and activation. It is associated with bone remodeling and repair, activation of NF-kappa B and c-jun N-terminal kinase, enhancement of T cell growth and dendritic cell function, immune cell function, lymph node development, thermal regulation, and mammary gland development. It is able to block TRANCE induced biological activity.
AA Sequence
<ADL>VTPPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLRRPPKEAQAYLPS<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
