Product Overview
Recombinant mouse OX40/TNFRSF4 , fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Description
TNFRSF4, also known as CD134, is a member of the TNFR-superfamily of receptors. This protein is a receptor for TNFSF4/OX40L/GP34 and a costimulatory molecule implicated in long-term T-cell immunity. OX40-OX40L interactions regulate antigen-specific T-cell expansion and survival, cytokine production. It also modulates cytokine receptor signalling. Therefore the interaction between TNFRSF4 and CD40L plays a key role in the development of multiple imflammatry and autoimmune disease. It has been implicated in the pathologic cytokine storm associated with certain viral infections, including the H5N1 bird flu.
AA Sequence
<DGSM>VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
