Product Overview
Recombinant mouse Tyro3, fused to hIgG-His-tag at C-terminus, was expressed in insect celland purified by using conventional chromatography techniques.
Description
Tyro3, also known as tyrosine-protein kinase receptor TYRO3 isoform A, is one of the receptor tyrosinekinase subfamily. It transduces signals from the extracellular matrix into the cytoplasm by binding to severalligands including TULP1 or GAS6. This protein regulates many physiological processes including cellsurvival, migration and differentiation. It activates the AKT survival pathway, including nuclear translocation of NF-kappa-B and upregulation of transcription of NF-kappa-B-regulated genes. This protein plays a role invarious processes such as neuron protection from excitotoxic injury, platelet aggregation and cytoskeletonreorganization.
AA Sequence
AGLKLMGAPVKMTVSQGQPVKLNCSVEGMEDPDIHWMKDGTVVQNASQVSISISEHSWIGLLSLKSVERSDAGLYWCQVKDGEETKISQSVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIYWWRGLTKVGGPAPSPSVLNVTGVTQRTEFSCEARNIKGLATSRPAIVRLQAPPAAPFNTTVTTISSYNASVAWVPGADGLALLHSCTVQVAHAPGEWEALAVVVPVPPFTCLLRNLAPATNYSLRVRCANALGPSPYGDWVPFQTKGLAPARAPQNFHAIRTDSGLILEWEEVIPEDPGEGPLGPYKLSWVQENGTQDELMVEGTRANLTDWDPQKDLILRVCASNAIGDGPWSQPLVVSSHDHAGRQGPPHSRTSW<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
