Product Overview
Purified recombinant protein of Mouse V-set immunoregulatory receptor (Vsir), transcript variant 2, with C-terminal Myc/DDK tag, expressed in HEK293T cells.
Description
Immunoregulatory receptor which inhibits the T-cell response (PubMed: 21383057, PubMed: 24743150, PubMed: 25267631). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (PubMed: 20042595). May stimulate MMP14-mediated MMP2 activation (By similarity).[UniProtKB/Swiss-Prot Function]
Form
25mM Tris.HCl, pH 7.3, 100mM glycine, 10% glycerol
AA Sequence
MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHRRAQELVRMDSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTPLSPPGPGDVFFPSLDPVPDSPNSEAITRTRPLEQKLISEEDLAANDILDYKDDDDKV