CD4
Cat#No# Product Name Expression System Species Protein length Tag Inquriy
IMP-1231 Recombinant Human CD4 protein, C-hFc tag HEK293 Human Lys26-Trp390 Inquiry
IMP-687 Recombinant Human CD4 protein, C-His tag HEK293 Human Lys26-Trp390 Inquiry
IMP-1384 Recombinant Human CD4 Protein, C-His&hFc-tagged HEK293 Human Met1-Trp390 Inquiry
IMP-1386 Recombinant Human CD4 Protein, C-His-tagged HEK293 Human Met1-Ser208 Inquiry
IMP-1547 Recombinant Mouse Cd4 Protein, C-His-tagged HEK293 Mouse Met1-Thr394 Inquiry
IMP-1548 Recombinant Rhesus CD4 Protein, C-His-tagged HEK293 Rhesus Met1-Trp390 Inquiry
IMP-1549 Recombinant Rhesus CD4 Protein, C-hFc-tagged HEK293 Rhesus Met1-Trp390 Inquiry
IMP-1576 Recombinant Human CD4 Protein, C-His-tagged, Biotinylated HEK293 Human Met1-Trp390 Inquiry
IMP-1577 Recombinant Mouse Cd4 Protein, C-His-tagged, Biotinylated HEK293 Mouse Met1-Thr394 Inquiry
IMP-1598 Recombinant Ferret CD4 Protein, C-His-tagged HEK293 Ferret Met1-Leu401 Inquiry
IMP-1599 Recombinant Rat Cd4 Protein, C-His-tagged HEK293 Rat Met1-Thr394 Inquiry
IMP-3058 Recombinant Rat CD4 protein, N-His Tag, OVA Conjugated Rat His21~Ser140 Inquiry
IMP-3053 Recombinant Human CD4 protein, N-His Tag E. coli Human Cys156~Ala310 Inquiry
IMP-3055 Recombinant Mouse CD4 protein, N-His Tag E. coli Mouse Val491~Ser679 Inquiry
IMP-3057 Recombinant Rabbit CD4 protein, N-His-GST Tag E. coli Rabbit Ser765~Gln902 Inquiry
IMP-3054 Recombinant Rhesus monkey CD4 protein, N-His Tag E. coli Rhesus monkey Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA Inquiry
IMP-6135 Recombinant Mouse CD4 Protein (27-394 aa), 6*His-tagged E. coli Mouse 27-394 Inquiry
IMP-6136 Recombinant Human CD4 Protein, GST-tagged E. coli Human Inquiry
IMP-6137 Recombinant Human CD4 Protein (419-458 aa), GST-tagged E. coli Human 419-458 Inquiry
IMP-6138 Recombinant Human CD4 Protein (26-226 aa), 6*His-tagged E. coli Human 26-226 Inquiry
IMP-6999 Recombinant Mouse Cd4 Protein, C-Myc/DDK-tagged HEK293T Mouse Inquiry
IMP-7000 Recombinant Human CD4 Protein, His-tagged E. coli Human Inquiry
IMP-7001 Recombinant Human CD4 Protein, C-Myc/DDK-tagged HEK293T Human Inquiry
IMP-8272 Recombinant Human CD4 protein, C-hFc Tag HEK293 Human 26-390aa Inquiry
IMP-8968 Recombinant Monkey CD4 Protein (1-398), His-tagged Human Monkey 1-398 Inquiry
IMP-9187 Recombinant Human CD4 Protein (26-390), C-His/Avi-tagged Human Human 26-390 Inquiry
IMP-9188 Recombinant Human CD4 Protein (1-458), N-GST-tagged Wheat Germ (in vitro) Human 1-458 Inquiry
IMP-9189 Recombinant Human CD4 Protein (1-458), N-GST-tagged Wheat Germ (in vitro) Human 1-458 Inquiry
IMP-9190 Recombinant Human CD4 Protein (Full Length), Tag free Wheat Germ (in vitro) Human Full Length Inquiry
IMP-3876 Recombinant Human CD4 protein, C-hFc Tag HEK293 Human 26-390aa Inquiry
IMP-10350 Recombinant Cotton Rat CD4 Protein (Met1-Pro393), C-6×His-tagged Mouse myeloma cell line Cotton Rat Met1-Pro393 Inquiry
IMP-10351 Recombinant Rat CD4 Protein (Met1-Thr394), C-6×His-tagged Mouse myeloma cell line Rat Met1-Thr394 Inquiry
IMP-10352 Recombinant Feline CD4 Protein (Met1-Leu413, Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), C-6×His-tagged Mouse myeloma cell line Feline Met1-Leu413, Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149 Inquiry
IMP-10353 Recombinant Mouse CD4 Protein (Lys27-Thr394), C-6×His-tagged Mouse myeloma cell line Mouse Lys27-Thr394 Inquiry
IMP-10354 Recombinant Canine CD4 Protein (Val25-Lys401), C-6×His-tagged Mouse myeloma cell line Canine Val25-Lys401 Inquiry
IMP-10370 Recombinant Human CD4 Protein (Lys26-Trp390) Sf 21 cells Human Lys26-Trp390 Inquiry
IMP-10371 Recombinant Human CD4 Protein (Lys26-Trp390) CHO Human Lys26-Trp390 Inquiry
IMP-10372 Recombinant Monkey CD4 Protein (Lys26-Pro396), C-hFc-tagged CHO Monkey Lys26-Pro396 Inquiry
IMP-10373 Recombinant Human CD4 Protein (Lys26-Trp390), C-hFc and Avi-tagged, Biotinylated CHO Human Lys26-Trp390 Inquiry
IMP-10374 Recombinant Monkey CD4 Protein (Lys26-Pro396), C-6×His-tagged CHO Monkey Lys26-Pro396 Inquiry
IMP-10601 Recombinant Human CD4 Protein (Lys26-Trp390), C-hFc-tagged CHO Human Lys26-Trp390 Inquiry
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info