IMP-1231 |
Recombinant Human CD4 protein, C-hFc tag |
HEK293 |
Human |
Lys26-Trp390 |
C-hFc tag |
Inquiry |
IMP-687 |
Recombinant Human CD4 protein, C-His tag |
HEK293 |
Human |
Lys26-Trp390 |
C-His tag |
Inquiry |
IMP-1384 |
Recombinant Human CD4 Protein, C-His&hFc-tagged |
HEK293 |
Human |
Met1-Trp390 |
C-His&hFc |
Inquiry |
IMP-1386 |
Recombinant Human CD4 Protein, C-His-tagged |
HEK293 |
Human |
Met1-Ser208 |
C-His |
Inquiry |
IMP-1547 |
Recombinant Mouse Cd4 Protein, C-His-tagged |
HEK293 |
Mouse |
Met1-Thr394 |
C-His |
Inquiry |
IMP-1548 |
Recombinant Rhesus CD4 Protein, C-His-tagged |
HEK293 |
Rhesus |
Met1-Trp390 |
C-His |
Inquiry |
IMP-1549 |
Recombinant Rhesus CD4 Protein, C-hFc-tagged |
HEK293 |
Rhesus |
Met1-Trp390 |
C-hFc |
Inquiry |
IMP-1576 |
Recombinant Human CD4 Protein, C-His-tagged, Biotinylated |
HEK293 |
Human |
Met1-Trp390 |
C-His |
Inquiry |
IMP-1577 |
Recombinant Mouse Cd4 Protein, C-His-tagged, Biotinylated |
HEK293 |
Mouse |
Met1-Thr394 |
C-His |
Inquiry |
IMP-1598 |
Recombinant Ferret CD4 Protein, C-His-tagged |
HEK293 |
Ferret |
Met1-Leu401 |
C-His |
Inquiry |
IMP-1599 |
Recombinant Rat Cd4 Protein, C-His-tagged |
HEK293 |
Rat |
Met1-Thr394 |
C-His |
Inquiry |
IMP-3058 |
Recombinant Rat CD4 protein, N-His Tag, OVA Conjugated |
|
Rat |
His21~Ser140 |
N-His Tag |
Inquiry |
IMP-3053 |
Recombinant Human CD4 protein, N-His Tag |
E. coli |
Human |
Cys156~Ala310 |
N-His Tag |
Inquiry |
IMP-3055 |
Recombinant Mouse CD4 protein, N-His Tag |
E. coli |
Mouse |
Val491~Ser679 |
N-His Tag |
Inquiry |
IMP-3057 |
Recombinant Rabbit CD4 protein, N-His-GST Tag |
E. coli |
Rabbit |
Ser765~Gln902 |
N-His-GST Tag |
Inquiry |
IMP-3054 |
Recombinant Rhesus monkey CD4 protein, N-His Tag |
E. coli |
Rhesus monkey |
Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA |
N-His Tag |
Inquiry |
IMP-6135 |
Recombinant Mouse CD4 Protein (27-394 aa), 6*His-tagged |
E. coli |
Mouse |
27-394 |
6*His |
Inquiry |
IMP-6136 |
Recombinant Human CD4 Protein, GST-tagged |
E. coli |
Human |
|
GST |
Inquiry |
IMP-6137 |
Recombinant Human CD4 Protein (419-458 aa), GST-tagged |
E. coli |
Human |
419-458 |
GST |
Inquiry |
IMP-6138 |
Recombinant Human CD4 Protein (26-226 aa), 6*His-tagged |
E. coli |
Human |
26-226 |
6*His |
Inquiry |
IMP-6999 |
Recombinant Mouse Cd4 Protein, C-Myc/DDK-tagged |
HEK293T |
Mouse |
|
C-Myc/DDK |
Inquiry |
IMP-7000 |
Recombinant Human CD4 Protein, His-tagged |
E. coli |
Human |
|
His |
Inquiry |
IMP-7001 |
Recombinant Human CD4 Protein, C-Myc/DDK-tagged |
HEK293T |
Human |
|
C-Myc/DDK |
Inquiry |
IMP-8272 |
Recombinant Human CD4 protein, C-hFc Tag |
HEK293 |
Human |
26-390aa |
C-hFc Tag |
Inquiry |
IMP-8968 |
Recombinant Monkey CD4 Protein (1-398), His-tagged |
Human |
Monkey |
1-398 |
His |
Inquiry |
IMP-9187 |
Recombinant Human CD4 Protein (26-390), C-His/Avi-tagged |
Human |
Human |
26-390 |
C-His/Avi |
Inquiry |
IMP-9188 |
Recombinant Human CD4 Protein (1-458), N-GST-tagged |
Wheat Germ (in vitro) |
Human |
1-458 |
N-GST |
Inquiry |
IMP-9189 |
Recombinant Human CD4 Protein (1-458), N-GST-tagged |
Wheat Germ (in vitro) |
Human |
1-458 |
N-GST |
Inquiry |
IMP-9190 |
Recombinant Human CD4 Protein (Full Length), Tag free |
Wheat Germ (in vitro) |
Human |
Full Length |
Tag free |
Inquiry |
IMP-3876 |
Recombinant Human CD4 protein, C-hFc Tag |
HEK293 |
Human |
26-390aa |
C-hFc Tag |
Inquiry |
IMP-10350 |
Recombinant Cotton Rat CD4 Protein (Met1-Pro393), C-6×His-tagged |
Mouse myeloma cell line |
Cotton Rat |
Met1-Pro393 |
C-6×His |
Inquiry |
IMP-10351 |
Recombinant Rat CD4 Protein (Met1-Thr394), C-6×His-tagged |
Mouse myeloma cell line |
Rat |
Met1-Thr394 |
C-6×His |
Inquiry |
IMP-10352 |
Recombinant Feline CD4 Protein (Met1-Leu413, Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), C-6×His-tagged |
Mouse myeloma cell line |
Feline |
Met1-Leu413, Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149 |
C-6×His |
Inquiry |
IMP-10353 |
Recombinant Mouse CD4 Protein (Lys27-Thr394), C-6×His-tagged |
Mouse myeloma cell line |
Mouse |
Lys27-Thr394 |
C-6×His |
Inquiry |
IMP-10354 |
Recombinant Canine CD4 Protein (Val25-Lys401), C-6×His-tagged |
Mouse myeloma cell line |
Canine |
Val25-Lys401 |
C-6×His |
Inquiry |
IMP-10370 |
Recombinant Human CD4 Protein (Lys26-Trp390) |
Sf 21 cells |
Human |
Lys26-Trp390 |
Tag Free |
Inquiry |
IMP-10371 |
Recombinant Human CD4 Protein (Lys26-Trp390) |
CHO |
Human |
Lys26-Trp390 |
Tag Free |
Inquiry |
IMP-10372 |
Recombinant Monkey CD4 Protein (Lys26-Pro396), C-hFc-tagged |
CHO |
Monkey |
Lys26-Pro396 |
C-hFc |
Inquiry |
IMP-10373 |
Recombinant Human CD4 Protein (Lys26-Trp390), C-hFc and Avi-tagged, Biotinylated |
CHO |
Human |
Lys26-Trp390 |
C-hFc and Avi |
Inquiry |
IMP-10374 |
Recombinant Monkey CD4 Protein (Lys26-Pro396), C-6×His-tagged |
CHO |
Monkey |
Lys26-Pro396 |
C-6×His |
Inquiry |
IMP-10601 |
Recombinant Human CD4 Protein (Lys26-Trp390), C-hFc-tagged |
CHO |
Human |
Lys26-Trp390 |
C-hFc |
Inquiry |