CD4
Cat#No# Product Name Expression System Species Protein length Tag Inquriy
IMP-1231 Recombinant Human CD4 protein, C-hFc tag HEK293 Human Lys26-Trp390 Inquiry
IMP-687 Recombinant Human CD4 protein, C-His tag HEK293 Human Lys26-Trp390 Inquiry
IMP-1384 Recombinant Human CD4 Protein, C-His&hFc-tagged HEK293 Human Met1-Trp390 Inquiry
IMP-1386 Recombinant Human CD4 Protein, C-His-tagged HEK293 Human Met1-Ser208 Inquiry
IMP-1547 Recombinant Mouse Cd4 Protein, C-His-tagged HEK293 Mouse Met1-Thr394 Inquiry
IMP-1548 Recombinant Rhesus CD4 Protein, C-His-tagged HEK293 Rhesus Met1-Trp390 Inquiry
IMP-1549 Recombinant Rhesus CD4 Protein, C-hFc-tagged HEK293 Rhesus Met1-Trp390 Inquiry
IMP-1576 Recombinant Human CD4 Protein, C-His-tagged, Biotinylated HEK293 Human Met1-Trp390 Inquiry
IMP-1577 Recombinant Mouse Cd4 Protein, C-His-tagged, Biotinylated HEK293 Mouse Met1-Thr394 Inquiry
IMP-1598 Recombinant Ferret CD4 Protein, C-His-tagged HEK293 Ferret Met1-Leu401 Inquiry
IMP-1599 Recombinant Rat Cd4 Protein, C-His-tagged HEK293 Rat Met1-Thr394 Inquiry
IMP-3058 Recombinant Rat CD4 protein, N-His Tag, OVA Conjugated Rat His21~Ser140 Inquiry
IMP-3053 Recombinant Human CD4 protein, N-His Tag E. coli Human Cys156~Ala310 Inquiry
IMP-3055 Recombinant Mouse CD4 protein, N-His Tag E. coli Mouse Val491~Ser679 Inquiry
IMP-3057 Recombinant Rabbit CD4 protein, N-His-GST Tag E. coli Rabbit Ser765~Gln902 Inquiry
IMP-3054 Recombinant Rhesus monkey CD4 protein, N-His Tag E. coli Rhesus monkey Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA Inquiry
IMP-6135 Recombinant Mouse CD4 Protein (27-394 aa), 6*His-tagged E. coli Mouse 27-394 Inquiry
IMP-6136 Recombinant Human CD4 Protein, GST-tagged E. coli Human Inquiry
IMP-6137 Recombinant Human CD4 Protein (419-458 aa), GST-tagged E. coli Human 419-458 Inquiry
IMP-6138 Recombinant Human CD4 Protein (26-226 aa), 6*His-tagged E. coli Human 26-226 Inquiry
IMP-6999 Recombinant Mouse Cd4 Protein, C-Myc/DDK-tagged HEK293T Mouse Inquiry
IMP-7000 Recombinant Human CD4 Protein, His-tagged E. coli Human Inquiry
IMP-7001 Recombinant Human CD4 Protein, C-Myc/DDK-tagged HEK293T Human Inquiry
IMP-8272 Recombinant Human CD4 protein, C-hFc Tag HEK293 Human 26-390aa Inquiry
IMP-8968 Recombinant Monkey CD4 Protein (1-398), His-tagged Human Monkey 1-398 Inquiry
IMP-9187 Recombinant Human CD4 Protein (26-390), C-His/Avi-tagged Human Human 26-390 Inquiry
IMP-9188 Recombinant Human CD4 Protein (1-458), N-GST-tagged Wheat Germ (in vitro) Human 1-458 Inquiry
IMP-9189 Recombinant Human CD4 Protein (1-458), N-GST-tagged Wheat Germ (in vitro) Human 1-458 Inquiry
IMP-9190 Recombinant Human CD4 Protein (Full Length), Tag free Wheat Germ (in vitro) Human Full Length Inquiry
IMP-3876 Recombinant Human CD4 protein, C-hFc Tag HEK293 Human 26-390aa Inquiry
IMP-10350 Recombinant Cotton Rat CD4 Protein (Met1-Pro393), C-6×His-tagged Mouse myeloma cell line Cotton Rat Met1-Pro393 Inquiry
IMP-10351 Recombinant Rat CD4 Protein (Met1-Thr394), C-6×His-tagged Mouse myeloma cell line Rat Met1-Thr394 Inquiry
IMP-10352 Recombinant Feline CD4 Protein (Met1-Leu413, Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), C-6×His-tagged Mouse myeloma cell line Feline Met1-Leu413, Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149 Inquiry
IMP-10353 Recombinant Mouse CD4 Protein (Lys27-Thr394), C-6×His-tagged Mouse myeloma cell line Mouse Lys27-Thr394 Inquiry
IMP-10354 Recombinant Canine CD4 Protein (Val25-Lys401), C-6×His-tagged Mouse myeloma cell line Canine Val25-Lys401 Inquiry
IMP-10370 Recombinant Human CD4 Protein (Lys26-Trp390) Sf 21 cells Human Lys26-Trp390 Inquiry
IMP-10371 Recombinant Human CD4 Protein (Lys26-Trp390) CHO Human Lys26-Trp390 Inquiry
IMP-10372 Recombinant Monkey CD4 Protein (Lys26-Pro396), C-hFc-tagged CHO Monkey Lys26-Pro396 Inquiry
IMP-10373 Recombinant Human CD4 Protein (Lys26-Trp390), C-hFc and Avi-tagged, Biotinylated CHO Human Lys26-Trp390 Inquiry
IMP-10374 Recombinant Monkey CD4 Protein (Lys26-Pro396), C-6×His-tagged CHO Monkey Lys26-Pro396 Inquiry
IMP-10601 Recombinant Human CD4 Protein (Lys26-Trp390), C-hFc-tagged CHO Human Lys26-Trp390 Inquiry
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info