CD44
Cat#No# Product Name Expression System Species Protein length Tag Inquriy
IMP-1047 Recombinant Human CD44 protein, C-His tag HEK293 Human Gln21-Pro220 Inquiry
IMP-1048 Recombinant Human CD44 protein, C-hFc tag HEK293 Human Gln21-Pro220 Inquiry
IMP-4245 Recombinant Mouse Cd44 Protein, C-His-tagged HEK293 Mouse Met1-Thr224 Inquiry
IMP-2660 Recombinant Human CD44 protein, N-His Tag, OVA Conjugated Human Glu1~Lys180 Inquiry
IMP-2662 Recombinant Human CD44 protein, N-His Tag HEK293 Human Val35~Asn242 Inquiry
IMP-2659 Recombinant Human CD44 protein, N-His Tag E. coli Human Ala21~Glu150 Inquiry
IMP-2658 Recombinant Rat CD44 protein, N-His Tag E. coli Rat Met12~Ala126 Inquiry
IMP-2661 Recombinant Rabbit CD44 protein, N-His Tag E. coli Rabbit Gly21~Glu147 Inquiry
IMP-2656 Recombinant Mouse CD44 protein, N-His Tag E.coli Mouse Gln23~Pro258 Inquiry
IMP-6038 Recombinant Human CD44 protein, C-mFc-Avi Tag HEK293 Human 21-220aa Inquiry
IMP-6486 Recombinant Human CD44 Protein (222-430 aa), GST-tagged E. coli Human 222-430 Inquiry
IMP-6487 Recombinant Human CD44 Protein (222-430 aa), 6*His-tagged E. coli Human 222-430 Inquiry
IMP-6488 Recombinant Human CD44 Protein (28-380 aa), 6*His-tagged E. coli Human 28-380 Inquiry
IMP-7002 Recombinant Mouse Cd44 Protein, C-Myc/DDK-tagged HEK293T Mouse Inquiry
IMP-7003 Recombinant Human CD44 Protein, C-Myc/DDK-tagged HEK293T Human Inquiry
IMP-7004 Recombinant Human CD44 Protein, C-Myc/DDK-tagged HEK293T Human Inquiry
IMP-9286 Recombinant Human CD44 Protein (1-699), N-GST-tagged Wheat Germ (in vitro) Human 1-699 Inquiry
IMP-9287 Recombinant Human CD44 Protein (1-361), N-GST-tagged Wheat Germ (in vitro) Human 1-361 Inquiry
IMP-9288 Recombinant Human CD44 Protein (Full Length), Tag free Wheat Germ (in vitro) Human Full Length Inquiry
IMP-10338 Recombinant Human CD44 Protein (Gln21-Pro220), C-hFc-tagged Mouse myeloma cell line Human Gln21-Pro220 Inquiry
IMP-10339 Recombinant Rat CD44 Protein (Gln22-Glu271), C-mFc-tagged Mouse myeloma cell line Rat Gln22-Glu271 Inquiry
IMP-10340 Recombinant Porcine CD44 Protein (Gln33-Thr234), C-hFc-tagged Mouse myeloma cell line Porcine Gln33-Thr234 Inquiry
IMP-10349 Recombinant Mouse CD44 Protein (Gln25-Thr224), C-mFc-tagged CHO Mouse Gln25-Thr224 Inquiry
IMP-10358 Recombinant Human CD44 Protein (Gln21-Thr222, NVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHST, Arg223-Trp269), C-hFc-tagged HEK293 Human Gln21-Thr222, NVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHST, Arg223-Trp269 Inquiry
IMP-10359 Recombinant Human CD44 Protein (Gln21-Thr222, NVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHST, Arg223-Trp269), C-6×His-tagged CHO Human Gln21-Thr222, NVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHST, Arg223-Trp269 Inquiry
IMP-10360 Recombinant Human CD44 Protein (Gln21-Thr222, IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG, Asp224-Trp269), C-hFc-tagged CHO Human Gln21-Thr222, IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG, Asp224-Trp269 Inquiry
IMP-10361 Recombinant Human CD44 Protein (Gln21-Thr222, IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG, Arg224-Trp269), C-6×His-tagged CHO Human Gln21-Thr222, IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG, Arg224-Trp269 Inquiry
IMP-10362 Recombinant Human CD44 Protein (Gln21-Thr222, NVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTST, Arg223-Trp269), C-hFc and Avi-tagged, Biotinylated HEK293 Human Gln21-Thr222, NVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTST, Arg223-Trp269 Inquiry
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info